PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G328900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 367aa    MW: 40905.6 Da    PI: 6.5157
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G328900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54.3e-151462148
                       TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                       +g+W +eEd +l+ +++++G+g +W + ++++g++R++k+c++rw++yl
  Aqcoe7G328900.1.p 14 KGPWAPEEDAKLKAYIEEYGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                       79*********************************************97 PP

2Myb_DNA-binding35.72e-1170111346
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         ++ eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  Aqcoe7G328900.1.p  70 GFSDEEDSIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                        699*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.959962IPR017930Myb domain
SuperFamilySSF466892.8E-2511109IPR009057Homeodomain-like
SMARTSM007179.2E-121364IPR001005SANT/Myb domain
PfamPF002494.6E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-241569IPR009057Homeodomain-like
CDDcd001671.75E-81662No hitNo description
PROSITE profilePS5129420.70163117IPR017930Myb domain
SMARTSM007172.6E-1067115IPR001005SANT/Myb domain
PfamPF002491.0E-969111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2270117IPR009057Homeodomain-like
CDDcd001674.61E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWAPE EDAKLKAYIE EYGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSDEEDSIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR  120
RKDSQARRLS SLNQDGKDGN GMDDNSYPHT LSNSALERMQ LHMQLQTLHN PLSFYNNPAL  180
WPKLHPMGDR NMQGHYSLNN NTPPSMQQVS NGQTALLREE KFLELPSSSI EQRANNSTKQ  240
DEKEDSFKGF TSSENSTGFN NGINSMGAAI MSKSSGAEEL NMNFQSVSSL QAELGDILYN  300
KTSGFIATED QINEFDCFKD MDGAKEGMIW WTNGFETKSS SSSSWDSASA LQTGGLFQDC  360
ELGYDI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007014145.11e-163Myb domain protein 36
SwissprotQ9FKL21e-102MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A061GXE31e-163A0A061GXE3_THECC; Myb domain protein 36
STRINGPOPTR_0018s10390.11e-153(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.17e-95myb domain protein 36